抗菌肽：对抗多药耐药之战的新希望

doi:10.24272/j.issn.2095-8137.2019.062

Abstract

Abstract:

The discovery of antibiotics marked a golden age in the revolution of human medicine. However, decades later, bacterial infections remain a global healthcare threat, and a return to the pre-antibiotic era seems inevitable if stringent measures are not adopted to curb the rapid emergence and spread of multidrug resistance and the indiscriminate use of antibiotics. In hospital settings, multidrug resistant (MDR) pathogens, including carbapenem-resistant Pseudomonas aeruginosa, vancomycin-resistant enterococci (VRE), methicillin-resistant Staphylococcus aureus (MRSA), and extended-spectrum β-lactamases (ESBL) bearing Acinetobacter baumannii, Escherichia coli, and Klebsiella pneumoniae are amongst the most problematic due to the paucity of treatment options, increased hospital stay, and exorbitant medical costs. Antimicrobial peptides (AMPs) provide an excellent potential strategy for combating these threats. Compared to empirical antibiotics, they show low tendency to select for resistance, rapid killing action, broad-spectrum activity, and extraordinary clinical efficacy against several MDR strains. Therefore, this review highlights multidrug resistance among nosocomial bacterial pathogens and its implications and reiterates the importance of AMPs as next-generation antibiotics for combating MDR superbugs.

Key words: Multidrug resistance, Nosocomial infections, Antimicrobial peptide, Antibiotic alternatives

James Mwangi, Xue Hao, Ren Lai, Zhi-Ye Zhang. Antimicrobial peptides: new hope in the war against multidrug resistance.2019.
Zoological Research, 40(6): 488-505.

Figures/Tables 4

Figure 1

Figure 2

Figure 3

Table 1

Select antimicrobial peptides with potent activity against MDR pathogens"

Peptide	Sequence	Development phase	Description
Human LL-37	[LL-37, 37 aa]		From human leucocytes, kills bacteria through pore formation and possesses immunomodulation activities.
SAAP-148 (de Breij et al., 2018)	LKRVWKRVFKLLKRYWRQLKKPVR	Preclinical	LL-37 derivative, shows potent bactericidal activity through membrane permeabilization and wound healing activity.
Cathelicidin-BF (Wang et al., 2008)	KFFRKLKKSVKKRAKEFFKKPRVIGVSIPF		Lysine-phenylalanine-rich peptide from snake venom. Shows potent efficacy against fungal and bacterial strains including MDR pathogens. Low hemolytic activity.
D-OH-CATH30 (Zhao et al., 2018)	KFFKKLKNSVKKRAKKFFKKPRVIGVSIPF	Preclinical	Cathelicidin from snake venom, rapidly kills MDR gram-positive and gram-negative pathogens, with low hemolytic activity and in vivo toxicity.
Indolicidin (Falla et al., 1996)	ILPWKWPWWPWRR	III	Isolated from bovine leucocytes, shows potent bactericidal activity through pore formation.
Omiganan (Melo & Castanho, 2007)	ILRWPWWPWRRK-NH₂	III	Indolicidin derivative, broad-spectrum antimicrobial activity, therapeutic agent against acne and catheter related infections.
Ci-MAM-A24 (Fedders et al., 2010)	WRSLGRTLLRLSHALKPLARRSGW-NH₂	Preclinical	Isolated from Ciona intestinalis, shows potent bactericidal activity against MRSA, VRE, and MDR P. aeruginosa through pore formation.
Pexiganan (Ge et al., 1999)	GIGKFLKKAKKFGKAFVKILKK-NH₂	III	Magainin analog, phase III clinical trials for treatment of bacterial infections and diabetic foot ulcers. Potent antimicrobial activity.
S-thanatin (Wu et al., 2011)	GSKKPVPIIYCNRRSGKCQRM	Preclinical	Thanatin derivative, shows improved antimicrobial activity with reduced hemolytic activity. Potently inhibits gram-negative growth in vitro and in vivo and alleviates sepsis in mice.
AA139 (van der Weide et al., 2019)	GFCWYVCARRNGARVCYRRCN	Preclinical	Analog of arenicin-3 with β-hairpin structure, exhibits potent microbicidal activity against MDR gram-negative pathogens, and excellent candidate for in vivo application.
SET-M33 (Van De Weide et al., 2019)	KKIRVRLSA)₄K₂KβΑ-ΟΗ	Preclinical	Synthetic tetra-branched peptide with potent microbicidal activity against MDR bacteria and in vivo therapeutic potential. Currently under development for treatment of sepsis and lung infections (Brunetti et al., 2016a).
EC-hepcidin3	APAKCTPYCYPTHDGVFCGVRCDFQ	Preclinical	Cysteine-rich peptide cloned from marine fish. Potent microbicidal activity against S. aureus and Pseudomonas spp.
Tachyplesin-1 (Ohta et al., 1992)	KWCFRVCYRG ICYRRCR	II	Cationic β-hairpin peptide from horseshoe crab. Potent microbicidal activity against gram-negative and gram-positive bacteria. Use limited by high cytotoxicity.

Table 1

References 0

	Adedeji WA . 2016. The treasure called antibiotics. Annals of Ibadan Postgraduate Medicine, 14(2): 56–57.
	Alanis AJ . 2005. Resistance to antibiotics: Are we in the post-antibiotic era?. Archives of Medical Research, 36(6): 697–705.
	Allen NE , Nicas TI . 2003. Mechanism of action of oritavancin and related glycopeptide antibiotics. FEMS Microbiology Reviews, 26(5): 511–532.
	Anderson DJ . 2011. Surgical site Infections. Infectious Disease Clinics of North America, 25(1): 135–153.
	Andersson DI, Hughes D , Kubicek-Sutherland JZ . 2016. Mechanisms and consequences of bacterial resistance to antimicrobial peptides. Drug Resistance Updates, 26: 43–57.
	Arias CA , Murray BE . 2012. The rise of the enterococcus: beyond vancomycin resistance. Nature Reviews Microbiology, 10(4): 266–278.
	Arias M , Piga KB , Hyndman ME , Vogel HJ . 2018. Improving the activity of trp-rich antimicrobial peptides by arg/lys substitutions and changing the length of cationic residues. Biomolecules, 8(2): 19.
	Aslam B , Wang W , Arshad MI, Khurshid M , Muzammil S , Rasool MH , Nisar MA, Alvi RF , Aslam MA, Qamar MU, Salamat MKF , Baloch Z . 2018. Antibiotic resistance: a rundown of a global crisis. Infection and Drug Resistance, 11: 1645–1658.
	Ayukekbong JA , Ntemgwa M , Atabe AN . 2017. The threat of antimicrobial resistance in developing countries: causes and control strategies. Antimicrobial Resistance & Infection Control, 6(1): 47.
	Bechinger B , Gorr SU . 2017. Antimicrobial peptides: mechanisms of action and resistance. Journal of Dental Research, 96(3): 254–260.
	Bei YH , Pan LL , Zhou QL , Zhao CM , Xie Y , Wu CF , Meng XM , Gu HY , Xu JH , Zhou L , Sluijter JPG , Das S , Agerberth B , Sun J , Xiao JJ . 2019. Cathelicidin-related antimicrobial peptide protects against myocardial ischemia/reperfusion injury. BMC Medicine, 17(1): 42.
	Bhat G , Kamath S , Hussain A . 2006. Nosocomial methicillin--resistant Staphylococcus aureus with reduced susceptibility to vancomycin. Indian Journal of Pathology & Microbiology, 49(2): 311–312.
	Å Björstad , Askarieh G , Brown KL , Christenson K , Forsman H , Önnheim K , Li H-N , Teneberg S , Maier O , Hoekstra D , Dahlgren C , Davidson DJ , Bylund J . 2009. The host defense peptide LL-37 selectively permeabilizes apoptotic leukocytes. Antimicrobial Agents and Chemotherapy, 53(3): 1027–1038.
	Blair JMA , Webber MA, Baylay AJ , Ogbolu DO , Piddock LJV . 2014. Molecular mechanisms of antibiotic resistance. Nature Reviews Microbiology, 13: 42–51.
	Brogden KA . 2005. Antimicrobial peptides: pore formers or metabolic inhibitors in bacteria?. Nature Reviews Microbiology, 3(3): 238–250.
	Brogden KA , Ackermann M , Mccray Jr PB , Tack BF . 2003. Antimicrobial peptides in animals and their role in host defences. International Journal of Antimicrobial Agents, 22(5): 465–478.
	Brown SE , Howard A , Kasprzak AB , Gordon KH , East PD . 2009. A peptidomics study reveals the impressive antimicrobial peptide arsenal of the wax moth Galleria mellonella . Insect Biochemistry and Molecular Biology, 39(11): 792–800.
	Brunetti J , Falciani C , Roscia G , Pollini S , Bindi S , Scali S , Arrieta UC , Gómez-Vallejo V , Quercini L , Ibba E , Prato M , Rossolini GM , Llop J , Bracci L , Pini A . 2016a. In vitro and in vivo efficacy, toxicity, bio-distribution and resistance selection of a novel antibacterial drug candidate. Scientific Reports, 6: 26077–26077.
	Brunetti J , Roscia G , Lampronti I , Gambari R , Quercini L , Falciani C , Bracci L , Pini A . 2016b. Immunomodulatory and anti-inflammatory activity in vitro and in vivo of a novel antimicrobial candidate. The Journal of Biological Chemistry, 291(49): 25742–25748.
	Cantisani M , Finamore E , Mignogna E , Falanga A , Nicoletti GF , Pedone C , Morelli G , Leone M , Galdiero M , Galdiero S . 2014. Structural insights into and activity analysis of the antimicrobial peptide myxinidin. Antimicrobial Agents and Chemotherapy, 58(9): 5280–5290.
	Centers for Disease Control and Prevention . 1997. Update: staphylococcus aureus with reduced susceptibility to vancomycin--united states, 1997. mmwr. Morbidity and Mortality Weekly Report, 46(35): 813–815.
	Chang S , Sievert DM , Hageman JC , Boulton ML , Tenover FC , Downes FP , Shah S , Rudrik JT , Pupp GR , Brown WJ , Cardo D , Fridkin SK . 2003. Infection with vancomycin-resistant Staphylococcus aureus containing the vana resistance gene. New England Journal of Medicine, 348(14): 1342–1347.
	Chen YX , Guarnieri MT , Vasil AI, Vasil ML , Mant CT , Hodges RS . 2007. Role of peptide hydrophobicity in the mechanism of action of alpha-helical antimicrobial peptides. Antimicrobial Agents and Chemotherapy, 51(4): 1398–1406.
	Chen YX , Mant CT , Farmer SW , Hancock REW , Vasil ML , Hodges RS . 2005. Rational design of alpha-helical antimicrobial peptides with enhanced activities and specificity/therapeutic index. The Journal of Biological Chemistry, 280(13): 12316–12329.
	Chou HT , Kuo TY , Chiang JC , Pei MJ , Yang WT , Yu HC , Lin SB , Chen WJ . 2008. Design and synthesis of cationic antimicrobial peptides with improved activity and selectivity against Vibrio spp. International Journal of Antimicrobial Agents, 32(2): 130–138.
	Chung PY , Khanum R . 2017. Antimicrobial peptides as potential anti-biofilm agents against multidrug-resistant bacteria. Journal of Microbiology, Immunology and Infection, 50(4): 405–410.
	Conlon JM . 2015. Host-defense peptides of the skin with therapeutic potential: from hagfish to human. Peptides, 67: 29–38.
	Craik DJ . 2012. Host-defense activities of cyclotides. Toxins (Basel), 4(2): 139–156.
	D’angelo I , Casciaro B , Miro A , Quaglia F , Mangoni ML , Ungaro F . 2015. Overcoming barriers in Pseudomonas aeruginosa lung infections: engineered nanoparticles for local delivery of a cationic antimicrobial peptide. Colloids and Surfaces B: Biointerfaces, 135: 717–725.
	Dathe M , Wieprecht T . 1999. Structural features of helical antimicrobial peptides: their potential to modulate activity on model membranes and biological cells. Biochimica et Biophysica Acta (BBA) - Biomembranes, 1462(1-2): 71–87.
	Davies J , Davies D . 2010. Origins and evolution of antibiotic resistance. Microbiology and Molecular Biology Reviews, 74(3): 417–433.
	de Breij A , Riool M , Cordfunke RA , Malanovic N , De Boer L , Koning RI , Ravensbergen E , Franken M , van der Heijde T , Boekema BK , Kwakman PHS , Kamp N , El Ghalbzouri A , Lohner K , SaJ Zaat , Drijfhout JW , Nibbering PH . 2018. The antimicrobial peptide SAAP-148 combats drug-resistant bacteria and biofilms. Science Translational Medicine, 10(423): eaan 4044.
	de Kraker MEA , Stewardson AJ , Harbarth S . 2016. Will 10 million people die a year due to antimicrobial resistance by 2050?. PLoS Medicine, 13(11): e1002184.
	De Y , Chen Q , Schmidt AP , Anderson GM , Wang JM , Wooters J , Oppenheim JJ , Chertov O . 2000. LL-37, the neutrophil granule-and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells. The Journal of Experimental Medicine, 192(7): 1069–1074.
	Denis O . 2017. Route of transmission of Staphylococcus aureus . The Lancet Infectious Diseases, 17(2): 124–125.
	Deslouches B , Di YP . 2017. Antimicrobial peptides: a potential therapeutic option for surgical site infections. Clinics in Surgery, 2: 1740.
	Destoumieux-Garzón D , Rosa RD , Schmitt P , Barreto C , Vidal-Dupiol J , Mitta G , Gueguen Y , Bachère E . 2016. Antimicrobial peptides in marine invertebrate health and disease. Philosophical Transactions of the Royal Society B: Biological Sciences, 371(1695): 20150300.
	Dever LA , Dermody TS . 1991. Mechanisms of bacterial resistance to antibiotics. JAMA Internal Medicine, 151(5): 886–895.
	Dhople V , Krukemeyer A , Ramamoorthy A . 2006. The human beta-defensin-3, an antibacterial peptide with multiple biological functions. Biochimica et Biophysica Acta (BBA) - Biomembranes, 1758(9): 1499–1512.
	Ding JX , Wu GQ , Zhao R , Li LX , Shen ZL , Xi T . 2009. Activity of S-thanatin thanatin analog against multidrug-resistant gram-negative organisms in vitro and the synergy with 7 kinds of antibiotics. Pharmaceutical biotechnology, 16(2): 158–161.
	Dotel R , O'sullivan M , Gilbert G . 2017. Staphylococcus aureus in critical care. The Lancet Infectious Diseases, 17(6): 579–580.
	Du H , Puri S , Mccall A , Norris HL , Russo T , Edgerton M . 2017. Human salivary protein histatin 5 has potent bactericidal activity against eskape pathogens. Frontiers in Cellular and Infection Microbiology, 7: 41.
	Dunne WM Jr . 2002. Bacterial adhesion: seen any good biofilms lately?. Clinical Microbiology Reviews, 15(2): 155–166.
	Dürr UHN , Sudheendra US , Ramamoorthy A . 2006. LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochimica et Biophysica Acta (BBA) - Biomembranes, 1758(9): 1408-1425.
	Edwards IA , Elliott AG , Kavanagh AM , Blaskovich MAT , Cooper MA . 2017. Structure-activity and-toxicity relationships of the antimicrobial peptide tachyplesin-1. ACS Infectious Diseases, 3(12): 917–926.
	Evans J , Wang YD , Shaw KP , Vernon LP . 1989. Cellular responses to Pyrularia thionin are mediated by Ca²⁺ influx and phospholipase A2 activation and are inhibited by thionin tyrosine iodination. Proceedings of the National Academy of Sciences of the United States of America, 86(15): 5849–5853.
	Falagas ME , Kasiakou SK , Saravolatz LD . 2005. Colistin: the revival of polymyxins for the management of multidrug-resistant gram-negative bacterial infections. Clinical Infectious Diseases, 40(9): 1333–1341.
	Falanga A , Galdiero S . 2018. Emerging therapeutic agents on the basis of naturally occurring antimicrobial peptides. The Royal Society of Chemistry, 42: 190–227.
	Falanga A , Lombardi L , Franci G , Vitiello M , Iovene MR , Morelli G , Galdiero M , Galdiero S . 2016. Marine antimicrobial peptides: nature provides templates for the design of novel compounds against pathogenic bacteria. International Journal of Molecular Sciences, 17(5): 785.
	Falciani C , Lozzi L , Pollini S , Luca V , Carnicelli V , Brunetti J , Lelli B , Bindi S , Scali S , Di Giulio A , Rossolini GM , Mangoni ML , Bracci L , Pini A . 2012. Isomerization of an antimicrobial peptide broadens antimicrobial spectrum to gram-positive bacterial pathogens. PLoS One, 7(10): e46259.
	Falla TJ , Karunaratne DN , Hancock REW . 1996. Mode of action of the antimicrobial peptide indolicidin. The Journal of Biological Chemistry, 271(32): 19298–19303.
	Fedders H , Podschun R , Leippe M . 2010. The antimicrobial peptide Ci-MAM-A24 is highly active against multidrug-resistant and anaerobic bacteria pathogenic for humans. International Journal of Antimicrobial Agents, 36(3): 264–266.
	Fernandez De Caleya R , Gonzalez-Pascual B , García-Olmedo F , Carbonero P . 1972. Susceptibility of phytopathogenic bacteria to wheat purothionins in vitro. Applied Microbiology, 23(5): 998–1000.
	Franchi D , Climo MW , Wong AH , Edmond MB , Wenzel RP . 1999. Seeking vancomycin resistant Staphylococcus aureus among patients with vancomycin-resistant enterococci. Clinical Infectious Diseases, 29(6): 1566–1568.
	Frecer V , Ho B , Ding JL . 2004. De novo design of potent antimicrobial peptides. Antimicrobial Agents and Chemotherapy, 48(9): 3349–3357.
	Gagnon MC , Strandberg E , Grau-Campistany A , Wadhwani P , Reichert J , Bürck J , Rabanal F , Auger M , Paquin JF , Ulrich AS . 2017. Influence of the length and charge on the activity of α-helical amphipathic antimicrobial peptides. Biochemistry, 56(11): 1680–1695.
	Ganz T . 2003. The role of antimicrobial peptides in innate immunity1. Integrative and Comparative Biology, 43(2): 300–304.
	Gao AG , Hakimi SM , Mittanck CA , Wu Y , Woerner BM , Stark DM , Shah DM , Liang J , Rommens CMT . 2000. Fungal pathogen protection in potato by expression of a plant defensin peptide. Nature Biotechnology, 18(12): 1307–1310.
	Gao YD , Fang HT , Fang L , Liu DW , Liu JS , Su MH , Fang Z , Ren WZ , Jiao HP . 2018. The modification and design of antimicrobial peptide. Current Pharmaceutical Design, 24(8): 904–910.
	Ge Y , Macdonald DL , Holroyd KJ , Thornsberry C , Wexler H , Zasloff M . 1999. In vitro antibacterial properties of pexiganan, an analog of magainin. Antimicrobial Agents and Chemotherapy, 43(4): 782–788.
	Gee ML , Burton M , Grevis-James A , Hossain MA, Mcarthur S , Palombo EA , Wade JD , Clayton AHA . 2013. Imaging the action of antimicrobial peptides on living bacterial cells. Scientific Reports, 3: 1557–1557.
	Gennaro R , Skerlavaj B , Romeo D . 1989. Purification, composition, and activity of two bactenecins, antibacterial peptides of bovine neutrophils. Infection and Immunity, 57(10): 3142–3146.
	Giacometti A , Cirioni O , Ghiselli R , Mocchegiani F , D'amato G , Circo R , Orlando F , Skerlavaj B , Silvestri C , Saba V , Zanetti M , Scalise G . 2004. Cathelicidin peptide sheep myeloid antimicrobial peptide-29 prevents endotoxin-induced mortality in rat models of septic shock. American Journal of Respiratory and Critical Care Medicine, 169(2): 187–194.
	Gold HS , Moellering RC . 1996. Antimicrobial-drug resistance. New England Journal of Medicine, 335(19): 1445–1453.
	Groisman EA , Ochman H . 1996. Pathogenicity islands: bacterial evolution in quantum leaps. Cell, 87(5): 791–794.
	Gudiol C , Carratalà J . 2014. Antibiotic resistance in cancer patients. Expert Review of Anti-infective Therapy, 12(8): 1003–1016.
	Guilhelmelli F , Vilela N , Albuquerque P , Derengowski LDS , Silva-Pereira I , Kyaw CM . 2013. Antibiotic development challenges: the various mechanisms of action of antimicrobial peptides and of bacterial resistance. Frontiers in Microbiology, 4: 353–353.
	Guo YJ , Xun M , Han J . 2018. A bovine myeloid antimicrobial peptide (BMAP-28) and its analogs kill pan-drug-resistant Acinetobacter baumannii by interacting with outer membrane protein A (OmpA). Medicine (Baltimore), 97(42): e12832–e12832.
	Gurung J , Khyriem AB , Banik A , Lyngdoh WV , Choudhury B , Bhattacharyya P . 2013. Association of biofilm production with multidrug resistance among clinical isolates of Acinetobacter baumannii and Pseudomonas aeruginosa from intensive care unit. Indian Journal of Critical Care Medicine, 17(4): 214–218.
	MGJL Habets , Brockhurst MA . 2012. Therapeutic antimicrobial peptides may compromise natural immunity. Biology Letters, 8(3): 416–418.
	Hammami R , Ben Hamida J , Vergoten G , Fliss I . 2009. Phytamp: a database dedicated to antimicrobial plant peptides. Nucleic Acids Research, 37 (Database issue): D963–D968.
	Han HM , Gopal R , Park Y . 2016. Design and membrane-disruption mechanism of charge-enriched AMPs exhibiting cell selectivity, high-salt resistance, and anti-biofilm properties. Amino Acids, 48(2): 505–522.
	Hancock REW , Brown KL , Mookherjee N . 2006. Host defence peptides from invertebrates – emerging antimicrobial strategies. Immunobiology, 211(4): 315–322.
	Hancock REW , Lehrer R . 1998. Cationic peptides: a new source of antibiotics. Trends in Biotechnology, 16(2): 82–88.
	Hancock REW , Nijnik A , Philpott DJ . 2012. Modulating immunity as a therapy for bacterial infections. Nature Reviews Microbiology, 10: 243–254.
	Hancock REW , Rozek A . 2002. Role of membranes in the activities of antimicrobial cationic peptides. FEMS Microbiology Letters, 206(2): 143–149.
	Hancock REW , Sahl HG . 2006. Antimicrobial and host-defense peptides as new anti-infective therapeutic strategies. Nature Biotechnology, 24: 1551–1557.
	Haney EF , Hancock REW . 2013. Peptide design for antimicrobial and immunomodulatory applications. Peptide Science, 100(6): 572–583.
	Harder J , Schröder JM , Gläser R . 2013. The skin surface as antimicrobial barrier: present concepts and future outlooks. Experimental Dermatology, 22(1): 1–5.
	Harwig SSL , Waring A , Yang HJ , Cho Y , Tan L , Lehrer RI . 1996. Intramolecular disulfide bonds enhance the antimicrobial and lytic activities of protegrins at physiological sodium chloride concentrations. European Journal of Biochemistry, 240(2): 352–357.
	He J , Anderson MH , Shi WY , Eckert R . 2009. Design and activity of a 'dual-targeted' antimicrobial peptide. International Journal of Antimicrobial Agents, 33(6): 532–537.
	Hilchie AL , Wuerth K , Hancock REW . 2013. Immune modulation by multifaceted cationic host defense (antimicrobial) peptides. Nature Chemical Biology, 9: 761–768.
	Hirsch EB , Tam VH . 2010. Impact of multidrug-resistant Pseudomonas aeruginosa infection on patient outcomes. Expert Review Pharmacoeconomics & Outcomes Research, 10(4): 441–451.
	Hong SY , Park TG , Lee KH . 2001. The effect of charge increase on the specificity and activity of a short antimicrobial peptide. Peptides, 22(10): 1669–1674.
	Huang YB , Huang JF , Chen YX . 2010. Alpha-helical cationic antimicrobial peptides: relationships of structure and function. Protein & Cell, 1(2): 143–152.
	Hurdle JG , O'neill AJ , Chopra I , Lee RE . 2011. Targeting bacterial membrane function: an underexploited mechanism for treating persistent infections. Nature Reviews Microbiolology, 9(1): 62–75.
	Jeannot K , Bolard A , Plésiat P . 2017. Resistance to polymyxins in gram-negative organisms. International Journal of Antimicrobial Agents, 49(5): 526–535.
	Jesus B , Antonio O , Jose-Maria GG . 2002. Mutation and evolution of antibiotic resistance: antibiotics as promoters of antibiotic resistance?. Current Drug Targets, 3(4): 345–349.
	Jiang ZQ , Vasil AI, Hale JD , Hancock REW , Vasil ML , Hodges RS . 2008. Effects of net charge and the number of positively charged residues on the biological activity of amphipathic alpha-helical cationic antimicrobial peptides. Biopolymers, 90(3): 369–383.
	Jin L , Bai XW , Luan N , Yao HM , Zhang ZY , Liu WH , Chen Y , Yan XW , Rong MQ , Lai R , Lu QM . 2016. A designed tryptophan-and lysine/arginine-rich antimicrobial peptide with therapeutic potential for clinical antibiotic-resistant Candida albicans vaginitis. Journal of Medicinal Chemistry, 59(5): 1791–1799.
	Jindal HM , Le CF , Mohd Yusof MY , Velayuthan RD , Lee VS , Zain SM , Isa DM , Sekaran SD . 2015. Antimicrobial activity of novel synthetic peptides derived from indolicidin and ranalexin against Streptococcus pneumoniae . PLoS One, 10(6): e0128532.
	Jing Y , Yue XC , Yang S , Li S . 2019. Association of aspirin resistance with increased mortality in ischemic stroke. The Journal of Nutrition, Health & Aging, 23(3): 266–270.
	Kang HK , Kim C , Seo CH , Park Y . 2017. The therapeutic applications of antimicrobial peptides (AMPs): a patent review. Journal of Microbiology, 55(1): 1–12.
	Keren I , Mulcahy LR , Lewis K . 2012. Persister eradication: lessons from the world of natural products. Methods in Enzymology, 517: 387–406.
	Khan HA , Baig FK , Mehboob R . 2017. Nosocomial infections: epidemiology, prevention, control and surveillance. Asian Pacific Journal of Tropical Biomedicine, 7(5): 478–482.
	Kim H , Jang JH , Kim SC , Cho JH . 2013. De novo generation of short antimicrobial peptides with enhanced stability and cell specificity. Journal of Antimicrobial Chemotherapy, 69(1): 121–132.
	Koenig SM , Truwit JD . 2006. Ventilator-associated pneumonia: diagnosis, treatment, and prevention. Clinical Microbiogy Reviews, 19(4): 637–657.
	Koo HB , Seo J . 2019. Antimicrobial peptides under clinical investigation. Peptide Science, doi: 10.1002/pep2.24122 . doi: 10.1002/pep2.24122
	Kościuczuk EM , Lisowski P , Jarczak J , Strzałkowska N , Jóźwik A , Horbańczuk J , Krzyżewski J , Zwierzchowski L , Bagnicka E . 2012. Cathelicidins: family of antimicrobial peptides. A review. Molecular Biolology Reports, 39(12): 10957–10970.
	Kubicek-Sutherland JZ , Lofton H , Vestergaard M , Hjort K , Ingmer H , Andersson DI . 2017. Antimicrobial peptide exposure selects for Staphylococcus aureus resistance to human defence peptides. The Journal of Antimicrobial Chemotherapy, 72(1): 115–127.
	Kumar P , Kizhakkedathu JN , Straus SK . 2018. Antimicrobial peptides: diversity, mechanism of action and strategies to improve the activity and biocompatibility in vivo. Biomolecules, 8(1): 4.
	Kümmerer K . 2004. Resistance in the environment. Journal of Antimicrobial Chemotherapy, 54(2): 311–320.
	Kurosaka K , Chen Q , Yarovinsky F , Oppenheim JJ , Yang D . 2005. Mouse cathelin-related antimicrobial peptide chemoattracts leukocytes using formyl peptide receptor-like 1/mouse formyl peptide receptor-like 2 as the receptor and acts as an immune adjuvant. The Journal of Immunology, 174(10): 6257–6265.
	Lai YP , Villaruz AE , Li M , Cha DJ , Sturdevant DE, Otto M . 2007. The human anionic antimicrobial peptide dermcidin induces proteolytic defence mechanisms in staphylococci. Molecular Microbiology, 63(2): 497–506.
	Laxminarayan R , Brown GM . 2001. Economics of antibiotic resistance: a theory of optimal use. Journal of Environmental Economics and Management, 42(2): 183–206.
	Lehrer RI , Barton A , Daher KA , Harwig SS , Ganz T , Selsted ME . 1989. Interaction of human defensins with Escherichia coli . mechanism of bactericidal activity. The Journal of Clinical Investigation, 84(2): 553–561.
	Levin AS , Barone AA , Penço J , Santos MV , Marinho IS , Arruda EAG , Manrique EI , Costa SF . 1999. Intravenous colistin as therapy for nosocomial infections caused by multidrug-resistant Pseudomonas aeruginosa and Acinetobacter baumannii . Clinical Infectious Diseases, 28(5): 1008–1011.
	Lewis K . 2008. Multidrug tolerance of biofilms and persister cells. In: Romeo T.Bacterial Biofilms. Berlin, Heidelberg: Springer Berlin Heidelberg, 107–131.
	Li JG , Koh JJ , Liu SP , Lakshminarayanan R , Verma CS , Beuerman RW . 2017. Membrane active antimicrobial peptides: translating mechanistic insights to design. Frontiers in Neuroscience, 11: 73–73.
	Li SA , Lee WH , Zhang Y . 2012. Efficacy of OH-CATH30 and its analogs against drug-resistant bacteria in vitro and in mouse models. Antimicrobial Agents and Chemotherapy, 56(6): 3309–3317.
	Lin J , Nishino K , Roberts MC , Tolmasky M , Aminov RI , Zhang LX . 2015. Mechanisms of antibiotic resistance. Frontiers in Microbiology, 6: 34. doi: 10.3389/fmicb.2015.00034 . doi: 10.3389/fmicb.2015.00034
	Linden PK . 2002. Treatment options for vancomycin-resistant enterococcal infections. Drugs, 62(3): 425–441.
	Liu B , Pop M . 2009. ARDB--antibiotic resistance genes database. Nucleic Acids Research, 37 (Database issue): D443–D447.
	Liu CB , Qi JL , Shan B , Ma YB . 2018. Tachyplesin causes membrane instability that kills multidrug-resistant bacteria by inhibiting the 3-ketoacyl carrier protein reductase fabG. Frontiers in Microbiology, 9: 825. doi: 10.3389/fmicb.2018.00825 . doi: 10.3389/fmicb.2018.00825
	Liu CB , Shan B , Bai HM , Tang J , Yan LZ , Ma YB . 2015. Hydrophilic/hydrophobic characters of antimicrobial peptides derived from animals and their effects on multidrug resistant clinical isolates. Zoological Research, 36(1): 41–47.
	Liu R , Liu H , Ma YF , Wu J , Yang HL , Ye HH , Lai R . 2011. There are abundant antimicrobial peptides in brains of two kinds of Bombina toads. Journal of Proteome Research, 10(4): 1806–1815.
	Liu YY , Wang Y , Walsh TR , Yi LX , Zhang R , Spencer J , Doi Y , Tian G , Dong B , Huang XH , Yu LF , Gu DX , Ren HW , Chen XJ , Lv LC , He DD , Zhou HW , Liang Z , Liu J-H , Shen JZ . 2016. Emergence of plasmid-mediated colistin resistance mechanism MCR-1 in animals and human beings in China: a microbiological and molecular biological study. The Lancet Infectious Diseases, 16(2): 161–168.
	Loeffler JM , Nelson D , Fischetti VA . 2001. Rapid killing of Streptococcus pneumoniae with a bacteriophage cell wall hydrolase. Science, 294(5549): 2170–2172.
	Lombardi L , Falanga A , Del Genio V , Galdiero S . 2019. A new hope: self-assembling peptides with antimicrobial activity. Pharmaceutics, 11(4): 166.
	Lu Y , Ma YF , Wang X , Liang JG , Zhang CX , Zhang KY , Lin GQ , Lai R . 2008. The first antimicrobial peptide from sea amphibian. Molecular Immunology, 45(3): 678–681.
	Lupei MI, Mann HJ , Beilman GJ , Oancea C , Chipman JG . 2010. Inadequate antibiotic therapy in solid organ transplant recipients is associated with a higher mortality rate. Surgical Infections, 11(1): 33–39.
	Lyu YF , Yang Y , Lyu X , Dong N , Shan A . 2016. Antimicrobial activity, improved cell selectivity and mode of action of short PMAP-36-derived peptides against bacteria and Candida. Scientific Reports, 6: 27258–27258.
	Macnair CR , Stokes JM , Carfrae LA , Fiebig-Comyn AA , Coombes BK , Mulvey MR , Brown ED . 2018. Overcoming mcr-1 mediated colistin resistance with colistin in combination with other antibiotics. Nature Communications, 9(1): 458.
	Mahlapuu M , Håkansson J , Ringstad L , Björn C . 2016a. Antimicrobial peptides: an emerging category of therapeutic agents. Frontiers in Cellular and Infection Microbiology, 6: 194–194.
	Manchanda V , Sanchaita S , Singh NP . 2010. Multidrug resistant acinetobacter. Journal of Global Infectious Diseases, 2(3): 291–304.
	Maróti G , Kereszt A , É Kondorosi , Mergaert P . 2011. Natural roles of antimicrobial peptides in microbes, plants and animals. Research in Microbiology, 162(4): 363–374.
	Martínez JL , Baquero F . 2002. Interactions among strategies associated with bacterial infection: pathogenicity, epidemicity, and antibiotic resistance. Clinical Microbiology Reviews, 15(4): 647–679.
	Martinez RM , Wolk DM . 2016. Bloodstream infections. In: Hayden R, Wolk D, Carroll K, Tang YW. Diagnostic Microbiology of the Immunocompromised Host, 2nd edn. Washington DC: ASM Press.
	Matsuzaki K . 1999. Why and how are peptide–lipid interactions utilized for self-defense? Magainins and tachyplesins as archetypes. Biochimica et Biophysica Acta (BBA) - Biomembranes, 1462(1-2): 1–10.
	Mcphee JB , Hancock REW . 2005. Function and therapeutic potential of host defence peptides. Journal of Peptide Science, 11(11): 677–687.
	Melo MN , MARB Castanho . 2007. Omiganan interaction with bacterial membranes and cell wall models. Assigning a biological role to saturation. Biochimica et Biophysica Acta (BBA) - Biomembranes, 1768(5): 1277–1290.
	Miller LG , Perdreau-Remington F , Rieg G , Mehdi S , Perlroth J , Bayer AS , Tang AW , Phung TO , Spellberg B . 2005. Necrotizing fasciitis caused by community-associated methicillin-resistant Staphylococcus aureus in Los Angeles. New England Journal of Medicine, 352(14): 1445–1453.
	Mills S , Serrano LM , Griffin C , O'connor PM , Schaad G , Bruining C , Hill C , Ross RP , Meijer WC . 2011. Inhibitory activity of Lactobacillus plantarum LMG P-26358 against Listeria innocua when used as an adjunct starter in the manufacture of cheese. Microbial Cell Factories, 10 (Suppl 1): S7–S7.
	Miyata T , Tokunaga F , Yoneya T , Yoshikawa K , Iwanaga S , Niwa M , Takao T , Shimonishi Y . 1989. Antimicrobial peptides, isolated from horseshoe crab hemocytes, tachyplesin II, and polyphemusins I and II: chemical structures and biological activity. The Journal of Biochemistry, 106(4): 663–668.
	Moncla BJ , Pryke K , Rohan LC , Graebing PW . 2011. Degradation of naturally occurring and engineered antimicrobial peptides by proteases. Advances in Bioscience and Biotechnology, 2(6): 404–408.
	Morita Y , Tomida J , Kawamura Y . 2012. Mexxy multidrug efflux system of Pseudomonas aeruginosa . Frontiers in Microbiology, 3: 408.
	Munita JM , Arias CA . 2016. Mechanisms of antibiotic resistance. Microbiology Spectrum, 4(2), doi: 10.1128/microbiolspec.VMBF-0016-2015.
	Mylonakis E , Podsiadlowski L , Muhammed M , Vilcinskas A . 2016. Diversity, evolution and medical applications of insect antimicrobial peptides. Philosophical Transactions of the Royal Society of London. Series B, Biological Sciences, 371(1695): 20150290.
	Nagarajan D , Roy N , Kulkarni O , Nanajkar N , Datey A , Ravichandran S , Thakur C , T S, Aprameya IV , Sarma SP , Chakravortty D , Chandra N . 2019. Ω76: A designed antimicrobial peptide to combat carbapenem-and tigecycline-resistant Acinetobacter baumannii . Science Advances, 5(7): eaax1946–eaax1946.
	Nakamura T , Furunaka H , Miyata T , Tokunaga F , Muta T , Iwanaga S , Niwa M , Takao T , Shimonishi Y . 1988. Tachyplesin, a class of antimicrobial peptide from the hemocytes of the horseshoe crab (Tachypleus tridentatus). Isolation and chemical structure. Journal of Biological Chemistry, 263(32): 16709–16713.
	Nawrot R , Barylski J , Nowicki G , Broniarczyk J , Buchwald W , Goździcka-Józefiak A . 2014. Plant antimicrobial peptides. Folia Microbiologica, 59(3): 181–196.
	Nicole JA , Amy TYY , Olga MP , Robert EWH . 2012. Therapeutic potential of host defense peptides in antibiotic-resistant infections. Current Pharmaceutical Design, 18(6): 807–819.
	Nicolle LE . 2014. Catheter associated urinary tract infections. Antimicrobial Resistance and Infection Control, 3: 23–23.
	Nijnik A , Hancock REW . 2009. Host defence peptides: antimicrobial and immunomodulatory activity and potential applications for tackling antibiotic-resistant infections. Emerging Health Threats Journal, 2: e1.
	Noble WC , Virani Z , Cree RGA . 1992. Co-transfer of vancomycin and other resistance genes from Enterococcus faecalis NCTC 12201 to Staphylococcus aureus . FEMS Microbiology Letters, 93(2): 195–198.
	Nordström R , Malmsten M . 2017. Delivery systems for antimicrobial peptides. Advances in Colloid and Interface Science, 242: 17–34.
	Ochoa TJ , Ruiz J , Molina M , Del Valle LJ , Vargas M , Gil AI, Ecker L , Barletta F , Hall E , Cleary TG , Lanata CF . 2009. High frequency of antimicrobial drug resistance of diarrheagenic Escherichia coli in infants in peru. The American Journal of Tropical Medicine and Hygiene, 81(2): 296–301.
	Ohta M , Ito H , Masuda K , Tanaka S , Arakawa Y , Wacharotayankun R , Kato N . 1992. Mechanisms of antibacterial action of tachyplesins and polyphemusins, a group of antimicrobial peptides isolated from horseshoe crab hemocytes. Antimicrobial Agents and Chemotherapy, 36(7): 1460–1465.
	Omardien S , Brul S , Zaat SAJ . 2016. Antimicrobial activity of cationic antimicrobial peptides against gram-positives: current progress made in understanding the mode of action and the response of bacteria. Frontiers in Cell and Developmental Biology, 4: 111–111.
	Oppenheim JJ , Biragyn A , Kwak LW , Yang D . 2003. Roles of antimicrobial peptides such as defensins in innate and adaptive immunity. Annals of the Rheumatic Diseases, 62(suppl 2): ii17–21.
	Othman HB , Halim RMA , Gomaa FAM , Amer MZ . 2019. Vancomycin MIC distribution among methicillin-resistant Staphylococcus aureus . Is reduced vancomycin susceptibility related to MIC creep?. Open Access Macedonian Journal of Medical Sciences, 7(1): 12–18.
	Panteleev PV , Bolosov IA , Balandin SV , Ovchinnikova TV . 2015. Structure and biological functions of β-hairpin antimicrobial peptides. Acta Naturae, 7(1): 37–47.
	Park CB , Kim HS , Kim SC . 1998. Mechanism of action of the antimicrobial peptide buforin II: buforin ii kills microorganisms by penetrating the cell membrane and inhibiting cellular functions. Biochemical and Biophysical Research Communications, 244(1): 253–257.
	Pasupuleti M , Schmidtchen A , Malmsten M . 2012. Antimicrobial peptides: key components of the innate immune system. Critical Reviews in Biotechnology, 32(2): 143–171.
	Paterson DL , Harris PNA . 2016. Colistin resistance: a major breach in our last line of defence. The Lancet Infectious Diseases, 16(2): 132–133.
	Patocka J , Nepovimova E , Klimova B , Wu QH , Kuca K . 2018. Antimicrobial peptides: amphibian host defense peptides. Current Medicinal Chemistry, 25: 1–21.
	Perron GG , Zasloff M , Bell G . 2006. Experimental evolution of resistance to an antimicrobial peptide. Proceedings of the Royal Society B: Biological sciences, 273(1583): 251–256.
	Peschel A , Otto M , Jack RW , Kalbacher H , Jung G , Götz F . 1999. Inactivation of the dlt operon Instaphylococcus aureus confers sensitivity to defensins, protegrins, and other antimicrobial peptides. Journal of Biological Chemistry, 274(13): 8405–8410.
	Peters L , Olson L , Khu DTK , Linnros S , Le NK , Hanberger H , Hoang NTB , Tran DM , Larsson M . 2019. Multiple antibiotic resistance as a risk factor for mortality and prolonged hospital stay: a cohort study among neonatal intensive care patients with hospital-acquired infections caused by gram-negative bacteria in Vietnam. PLoS One, 14(5): e0215666.
	Philippe B , Reto S . 2005. Insect antimicrobial peptides: structures, properties and gene regulation. Protein & Peptide Letters, 12(1): 3–11.
	Phillips I , Casewell M , Cox T , De Groot B , Friis C , Jones R , Nightingale C , Preston R , Waddell J . 2004. Does the use of antibiotics in food animals pose a risk to human health? A critical review of published data. Journal of Antimicrobial Chemotherapy, 53(1): 28–52.
	Poirel L , Jayol A , Nordmann P . 2017. Polymyxins: Antibacterial activity, susceptibility testing, and resistance mechanisms encoded by plasmids or chromosomes. Clinical Microbiology Reviews, 30(2): 557–596.
	Price JR , Cole K , Bexley A , Kostiou V , Eyre DW , Golubchik T , Wilson DJ , Crook DW , Walker AS , Peto TEA , Llewelyn MJ , Paul J . 2017. Transmission of Staphylococcus aureus between health-care workers, the environment, and patients in an intensive care unit: a longitudinal cohort study based on whole-genome sequencing. The Lancet Infectious Diseases, 17(2): 207–214.
	Qi RH , Chen Y , Guo ZL , Zhang F , Fang Z , Huang K , Yu HN , Wang YP . 2019. Identification and characterization of two novel cathelicidins from the frog Odorrana livida . Zoological Research, 40(2): 94–101.
	Qu HD , Chen B , Peng H , Wang KJ . 2013. Molecular cloning, recombinant expression, and antimicrobial activity of EC-hepcidin3, a new four-cysteine hepcidin isoform from Epinephelus coioides . Bioscience, Biotechnology, and Biochemistry, 77(1): 103–110.
	Rai DK , Qian S . 2017. Interaction of the antimicrobial peptide aurein 1.2 and charged lipid bilayer. Scientific Reports, 7(1): 3719.
	Rapoport M , Faccone D , Pasteran F , Ceriana P , Albornoz E , Petroni A , Corso A . 2016. First description of mcr-1-mediated colistin resistance in human infections caused by Escherichia coli in Latin America. Antimicrobial Agents and Chemotherapy, 60(7): 4412.
	Reddy KVR , Yedery RD , Aranha C . 2004. Antimicrobial peptides: premises and promises. International Journal of Antimicrobial Agents, 24(6): 536–547.
	Richard P , Floch RL , Chamoux C , Pannier M , Espaze E , Richt H . 1994. Pseudomonas aeruginosa outbreak in a burn unit: role of antimicrobials in the emergence of multiply resistant strains. The Journal of Infectious Diseases, 170(2): 377–383.
	Rinaldi AC . 2002. Antimicrobial peptides from amphibian skin: an expanding scenario: commentary. Current Opinion in Chemical Biology, 6(6): 799–804.
	Rodríguez-Vázquez N , Lionel Ozores H , Guerra A , González-Freire E , Fuertes A , Panciera M , Priegue JM , Outeiral J , Montenegro J , Garcia-Fandino R , Amorín M , Granja JR . 2014. Membrane-targeted self-assembling cyclic peptide nanotubes. Current Topics in Medicinal Chemistry, 14(23): 2647–2461.
	Rollins-Smith LA , Reinert LK , O'leary CJ , Houston LE, Woodhams DC . 2005. Antimicrobial peptide defenses in amphibian skin. Integrative and Comparative Biology, 45(1): 137–142.
	Rose AS , Bradley AR , Valasatava Y , Duarte JM , Prlić A , Rose PW . 2018. NGL viewer: web-based molecular graphics for large complexes. Bioinformatics, 34(21): 3755–3758.
	Rozgonyi F , Szabo D , Kocsis B , Ostorhazi E , Abbadessa G , Cassone M , Wade JD,L . Otvos J . 2009. The antibacterial effect of a proline-rich antibacterial peptide A3-APO. Current Medicinal Chemistry, 16(30): 3996–4002.
	Sader HS , Fedler KA , Rennie RP , Stevens S , Jones RN . 2004. Omiganan pentahydrochloride (MBI 226), a topical 12-amino-acid cationic peptide: spectrum of antimicrobial activity and measurements of bactericidal activity. Antimicrobial Agents and Chemotherapy, 48(8): 3112–3118.
	Sarma P , Mahendiratta S , Prakash A , Medhi B . 2018. Specifically targeted antimicrobial peptides: a new and promising avenue in selective antimicrobial therapy. Indian Journal of Pharmacology, 50(1): 1–3.
	Schmidtchen A , Pasupuleti M , Malmsten M . 2014. Effect of hydrophobic modifications in antimicrobial peptides. Advances in Colloid and Interface Science, 205: 265–274.
	Shai Y . 2002. Mode of action of membrane active antimicrobial peptides. Peptide Science, 66(4): 236–248.
	Sharma H , Nagaraj R . 2015. Human β-defensin 4 with non-native disulfide bridges exhibit antimicrobial activity. PLoS One, 10(3): e0119525.
	Sieprawska-Lupa M , Mydel P , Krawczyk K , Wójcik K , Puklo M , Lupa B , Suder P , Silberring J , Reed M , Pohl J , Shafer W , Mcaleese F , Foster T , Travis J , Potempa J . 2004. Degradation of human antimicrobial peptide LL-37 by Staphylococcus aureus-derived proteinases. Antimicrobial Agents and Chemotherapy, 48(12): 4673–4679.
	Sierra JM , Fusté E , Rabanal F , Vinuesa T , Viñas M . 2017. An overview of antimicrobial peptides and the latest advances in their development. Expert Opinion on Biological Therapy, 17(6): 663–676.
	Silva CCG , Silva SPM , Ribeiro S . 2018. Application of bacteriocins and protective cultures in dairy food preservation. Frontiers in Microbiology, 9: 594.
	Silveira E , Freitas AR , Peixe L , Novais C . 2009. Environmental spread of antibiotic molecules, antibiotic resistant bacteria and genes: jigsaw pieces of a public health problem. Revista da Faculdade de Ciencias da Sande, 6: 244–253.
	Starr CG , Wimley WC . 2017. Antimicrobial peptides are degraded by the cytosolic proteases of human erythrocytes. Biochimica et Biophysica Acta - Biomembranes, 1859(12): 2319–2326.
	Stec B . 2006. Plant thionins – the structural perspective. Cellular and Molecular Life Sciences CMLS, 63(12): 1370–1385.
	Stefania G , Annarita F , Rita B , Paolo G , Giancarlo M , Massimiliano G . 2015. Antimicrobial peptides as an opportunity against bacterial diseases. Current Medicinal Chemistry, 22(14): 1665–1677.
	Stewart PS . 2002. Mechanisms of antibiotic resistance in bacterial biofilms. International Journal of Medical Microbiology, 292(2): 107–113.
	Stotz HU, Thomson JG , Wang Y . 2009. Plant defensins: defense, development and application. Plant Signaling & Behavior, 4(11): 1010–1012.
	Struelens MJ . 1998. The epidemiology of antimicrobial resistance in hospital acquired infections: problems and possible solutions. British Medical Journal, 317(7159): 652–654.
	Tachi T , Epand RF , Epand RM , Matsuzaki K . 2002. Position-dependent hydrophobicity of the antimicrobial magainin peptide affects the mode of peptide-lipid interactions and selective toxicity. Biochemistry, 41(34): 10723–10731.
	Tam JP , Wang SJ , Wong KH , Tan WL . 2015. Antimicrobial peptides from plants. Pharmaceuticals (Basel), 8(4): 711–757.
	Tavares LS , Santos MDO , Viccini LF , Moreira JS , Miller RNG , Franco OL . 2008. Biotechnological potential of antimicrobial peptides from flowers. Peptides, 29(10): 1842–1851.
	Tincu JA , Taylor SW . 2004. Antimicrobial peptides from marine invertebrates. Antimicrobial Agents and Chemotherapy, 48(10): 3645–3654.
	Tong ZC , Ni LX , Ling JQ . 2014. Antibacterial peptide nisin: a potential role in the inhibition of oral pathogenic bacteria. Peptides, 60: 32–40.
	Treffers C , Chen L , Anderson RC , Yu PL . 2005. Isolation and characterisation of antimicrobial peptides from deer neutrophils. International Journal of Antimicrobial Agents, 26(2): 165–169.
	Tzong-Hsien L , Kristopher NH , Marie-Isabel A . 2016. Antimicrobial peptide structure and mechanism of action: a focus on the role of membrane structure. Current Topics in Medicinal Chemistry, 16(1): 25–39.
	Ulm H , Wilmes M , Shai Y , Sahl HG . 2012. Antimicrobial host defensins- specific antibiotic activities and innate defense modulation. Frontiers in Immunology, 3: 249–249.
	van Boeckel TP , Brower C , Gilbert M , Grenfell BT , Levin SA , Robinson TP , Teillant A , Laxminarayan R . 2015. Global trends in antimicrobial use in food animals. Proceedings of the National Academy of Sciences of the United States of America, 112(18): 5649–5654.
	van der Weide H , Brunetti J , Pini A , Bracci L , Ambrosini C , Lupetti P , Paccagnini E , Gentile M , Bernini A , Niccolai N , Jongh DV , IAJM Bakker-Woudenberg , Goessens WHF , Hays JP , Falciani CS . 2017. Investigations into the killing activity of an antimicrobial peptide active against extensively antibiotic-resistant K . pneumoniae and P. aeruginosa. Biochimica et Biophysica Acta (BBA) - Biomembranes, 1859(10): 1796–1804.
	van der Weide H , Vermeulen-De Jongh DMC , van der Meijden A , Boers SA , Kreft D , Ten Kate MT , Falciani C , Pini A , Strandh M , IAJM Bakker-Woudenberg , Hays JP , Goessens WHF . 2019. Antimicrobial activity of two novel antimicrobial peptides AA139 and SET-M33 against clinically and genotypically diverse Klebsiella pneumoniae isolates with differing antibiotic resistance profiles. International Journal of Antimicrobial Agents, 54(2): 159–166.
	van't Hof W , Veerman ECI , Helmerhorst EJ , Amerongen AVN . 2001. Antimicrobial peptides: Properties and applicability. Biological Chemistry, 382(4): 597–619.
	Wakabayashi H , Hiratani T , Uchida K , Yamaguchi H . 1996. Antifungal spectrum and fungicidal mechanism of an N-terminal peptide of bovine lactoferrin. Journal of Infection and Chemotherapy, 1(3): 185–189.
	Wang GS , Li X , Wang Z . 2016. APD3: the antimicrobial peptide database as a tool for research and education. Nucleic Acids Research, 44(D1): D1087–D1093.
	Wang GX , Wang Y , Ma DY , Liu H , Li JX , Zhang KY , Yang XL , Lai R , Liu JZ . 2013. Five novel antimicrobial peptides from the kuhl’s wart frog skin secretions, Limnonectes kuhlii . Molecular Biology Reports, 40(2): 1097–1102.
	Wang YP , Hong J , Liu XH , Yang HL , Liu R , Wu J , Wang A , Lin DH , Lai R . 2008. Snake cathelicidin from Bungarus fasciatus is a potent peptide antibiotics. PLoS One, 3(9): e3217–e3217.
	Wang YP , Zhang ZY , Chen LL , Guang HJ , Li Z , Yang HL , Li JX , You DW , Yu HN , Lai R . 2011. Cathelicidin-BF, a snake cathelicidin-derived antimicrobial peptide, could be an excellent therapeutic agent for acne vulgaris. PLoS One, 6(7): e22120–e22120.
	Wang ZL , Wang XM , Wang JH . 2018. Recent Advances in antibacterial and antiendotoxic peptides or proteins from marine resources. Marine Drugs, 16(2): 57.
	WHO . 2014. Antimicrobial resistance: Global report on surveillance. https://www.who.int/drugresistance/documents/AMR_report_Web_slide_set.pdf.
	Wimley WC . 2010. Describing the mechanism of antimicrobial peptide action with the interfacial activity model. ACS Chemical Biology, 5(10): 905–917.
	Woodhams DC , Ardipradja K , Alford RA , Marantelli G , Reinert LK , Rollins-Smith LA . 2007. Resistance to chytridiomycosis varies among amphibian species and is correlated with skin peptide defenses. Animal Conservation, 10(4): 409–417.
	Wu GQ , Li XF , Fan XB , Wu HB , Wang SL , Shen ZL , Xi T . 2011. The activity of antimicrobial peptide S-thanatin is independent on multidrug-resistant spectrum of bacteria. Peptides, 32(6): 1139–1145.
	Wu GQ , Wu PP , Xue XL , Yan XJ , Liu S , Zhang C , Shen ZL , Xi T . 2013. Application of S-thanatin, an antimicrobial peptide derived from thanatin, in mouse model of Klebsiella pneumoniae infection. Peptides, 45: 73–77.
	Wu QH , Patočka J , Kuča K . 2018. Insect antimicrobial peptides, a mini review. Toxins (Basel), 10(11): 461.
	Xhindoli D , Pacor S , Benincasa M , Scocchi M , Gennaro R , Tossi A . 2016. The human cathelicidin LL-37 — a pore-forming antibacterial peptide and host-cell modulator. Biochimica et Biophysica Acta (BBA) - Biomembranes, 1858(3): 546-–566.
	Xiao Y , Liu CB , Lai R . 2011. Antimicrobial peptides from amphibians. BioMolecular Concepts, 2(1-2): 27–38.
	Yamaguchi Y , Ouchi Y . 2012. Antimicrobial peptide defensin: identification of novel isoforms and the characterization of their physiological roles and their significance in the pathogenesis of diseases. Proceedings of the Japan Academy. Series B, Physical and Biological Sciences, 88(4): 152–166.
	Yamamoto Y , Kawahara R , Fujiya Y , Sasaki T , Hirai I , Khong DT , Nguyen TN , Nguyen BX . 2018. Wide dissemination of colistin-resistant Escherichia coli with the mobile resistance gene mcr in healthy residents in Vietnam. Journal of Antimicrobial Chemotherapy, 74(2): 523–524.
	Yamauchi K , Tomita M , Giehl TJ , Ellison RT , 3rd . 1993. Antibacterial activity of lactoferrin and a pepsin-derived lactoferrin peptide fragment. Infection and Immunity, 61(2): 719–728.
	Yang SC , Lin CH , Sung CT , Fang JY . 2014. Antibacterial activities of bacteriocins: application in foods and pharmaceuticals. Frontiers in Microbiology, 5: 241.
	Yang ST , Yub Shin S , Kim YC , Kim Y , Hahm KS , Kim JI . 2002. Conformation-dependent antibiotic activity of tritrpticin, a cathelicidin-derived antimicrobial peptide. Biochemical and Biophysical Research Communications, 296(5): 1044–1050.
	Yeaman MR , Yount NY . 2003. Mechanisms of antimicrobial peptide action and resistance. Pharmacological Reviews, 55(1): 27–55.
	Yi HY , Chowdhury M , Huang YD , Yu XQ . 2014. Insect antimicrobial peptides and their applications. Applied Microbiology and Biotechnology, 98(13): 5807–5822.
	Yüksel E , Karakeçili A , Demirtaş TT , Gümüşderelioğlu M . 2016. Preparation of bioactive and antimicrobial PLGA membranes by magainin II/EGF functionalization. International Journal of Biological Macromolecules, 86: 162–168.
	Zaman SB , Hussain MA, Nye R , Mehta V , Mamun KT , Hossain N . 2017. A review on antibiotic resistance: alarm bells are ringing. Cureus, 9(6): e1403.
	Zasloff M . 1987. Magainins, a class of antimicrobial peptides from xenopus skin: isolation, characterization of two active forms, and partial cDNA sequence of a precursor. Proceedings of the National Academy of Sciences of the United States of America, 84(15): 5449–5453.
	Zerweck J , Strandberg E , Kukharenko O , Reichert J , Bürck J , Wadhwani P , Ulrich AS . 2017. Molecular mechanism of synergy between the antimicrobial peptides PGLa and magainin 2. Scientific Reports, 7(1): 13153.
	Zhang F , Guo ZL , Chen Y , Li L , Yu HN , Wang YP . 2019. Effects of C-terminal amidation and heptapeptide ring on the biological activities and advanced structure of amurin-9KY, a novel antimicrobial peptide identified from the brown frog, Rana kunyuensis . Zoological Research, 40(3): 198–204.
	Zhang LJ , Gallo RL . 2016. Antimicrobial peptides. Current Biology, 26(1): R14–R19.
	Zhang Y . 2006. Amphibian skin secretions and bio-adaptive significance —implications from Bombina maxima skin secretion proteome. Zoological Research, 27(1): 101–112.
	Zhang Y . 2015. Why do we study animal toxins?. Zoological Research, 36(4): 183–22.
	Zhang YX , Zou AH , Manchu RG , Zhou YC , Wang SF . 2008. Purification and antimicrobial activity of antimicrobial protein from brown-spotted grouper, Epinephelus fario . Zoological Research, 29(6): 627–632.
	Zhang ZY , Meng P , Han Y , Shen CB , Li BW , Hakim MA, Zhang XG , Lu QM , Rong MQ , Lai R . 2015. Mitochondrial DNA-LL-37 complex promotes atherosclerosis by escaping from autophagic recognition. Immunity, 43(6): 1137–1147.
	Zhao CX , Dwyer MD , Yu AL , Wu Y , Fang S , Middelberg APJ . 2015. A simple and low-cost platform technology for producing pexiganan antimicrobial peptide in E . coli. Biotechnology and Bioengineering, 112(5): 957–964.
	Zhao F , Lan XQ , Du Y , Chen PY , Zhao J , Zhao F , Lee WH , Zhang Y . 2018. King cobra peptide OH-CATH30 as a potential candidate drug through clinic drug-resistant isolates. Zoological Research, 39(2): 87–96.
	Zhao XW , Wu HY , Lu HR , Li GD , Huang QS . 2013. LAMP: A database linking antimicrobial peptides. PLoS One, 8(6): e66557.
	Zhao YY , Zhang M , Qiu S , Wang JY , Peng JX , Zhao P , Zhu RR , Wang HL , Li Y , Wang KR , Yan WJ , Wang R . 2016. Antimicrobial activity and stability of the D-amino acid substituted derivatives of antimicrobial peptide polybia-MPI. AMB Express, 6(1): 122.
	Zhong J , Wang WH , Yang XM , Yan XW , Liu R . 2013. A novel cysteine-rich antimicrobial peptide from the mucus of the snail of Achatina fulica . Peptides, 39: 1–5.

[1]	Fen Zhang, Zhi-Lai Guo, Yan Chen, Li Li, Hai-Ning Yu, Yi-Peng Wang. Effects of C-terminal amidation and heptapeptide ring on the biological activities and advanced structure of amurin-9KY, a novel antimicrobial peptide identified from the brown frog, Rana kunyuensis [J]. Zoological Research, 2019, 40(3): 198-204.
[2]	Ruo-Han Qi, Yan Chen, Zhi-Lai Guo, Fen Zhang, Zheng Fang, Kai Huang, Hai-Ning Yu, Yi-Peng Wang. Identification and characterization of two novel cathelicidins from the frog Odorrana livida [J]. Zoological Research, 2019, 40(2): 94-101.
[3]	Bai-Yu ZHANG, Si-Man LI, Zheng-Hua GAO, Ji-Hong SHEN. Protective effects of snake venom antimicrobial peptide OH-CATH on E. coli induced rabbit urinary tract infection models [J]. Zoological Research, 2013, 34(1): 25-32.
[4]	WANG Yi-Peng,LAI Ren. Insect Antimicrobial Peptides: Structures, Properties and Gene Regulation [J]. Zoological Research, 2010, 31(1): 27-34.
[5]	Chen Xin-xin,Yu guo-yu,ZHAN Yan,Zhang Yun,Shen Ji-hong,Lee We. Effects of the Antimicrobial Peptide OH-CATH on Escherichia coli [J]. Zoological Research, 2009, 30(2): 171-177.
[6]	ZHANG Yun^. Amphibian Skin Secretions and Bio-adaptive Significance —Implications from Bombina maxima* Skin Secretion Proteome [J]. Zoological Research, 2006, 27(1): 101-112.
[7]	AN Xian-hui,LV Yi,LI Wei-guo,LIANG Jian-guo,XU Chun-hua,ZHANG Chong-xing et al.. Antimicrobial Peptides Purified from Penus chinensis [J]. Zoological Research, 2005, 26(4): 410-415.

Antimicrobial peptides: new hope in the war against multidrug resistance

RichHTML

PDF (PC)

Like

Knowledge

Abstract

Cite this article

share this article

Support info

Figures/Tables 4

References 0

Related Articles 7

Metrics

Comments

Recommended 0